PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g100930.1
Common NameMTR_2g100930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 354aa    MW: 38308.8 Da    PI: 7.631
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g100930.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-14110154347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Medtr2g100930.1 110 PWTEEEHRLFLVGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 154
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.0E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.366103159IPR017930Myb domain
SuperFamilySSF466894.64E-17105160IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-19106158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.6E-12107153IPR009057Homeodomain-like
SMARTSM007172.1E-11107157IPR001005SANT/Myb domain
PfamPF002491.3E-11110154IPR001005SANT/Myb domain
CDDcd001671.14E-9110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RTAAAGGVKL FGVRLTDGSI IKKSASMGNL NLAALHHSSS  60
SSSLNPGSSL NPGSPCFEPP HDPDGYLSDD PVHASSAFAT RRSERKKGVP WTEEEHRLFL  120
VGLQKLGKGD WRGIARNFVV SRTPTQVASH AQKYFIRQSN ATRRKRRSSL FDMAPDVCPD  180
STSMPEEQVL LPPSENSQPC NGKSQPSLNL SLKSEYEPME TTSEENIEEA NETTMGSNGF  240
TPMTQGFFPP YLPASFSIWP SIGAPFEEVN RGETSHHQVL KPIPVIPKEP VNVDELVGMS  300
HLSIGETRVL DREPSPLSLK LLGEPSRQSA FHANAPVGGS DLNSGKNNAI QAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.36790.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684860.0EF468486.1 Medicago truncatula MYB transcription factor MYB52 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597679.10.0MYB-like transcription factor family protein
TrEMBLG7II010.0G7II01_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-105MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]